PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_18.215
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family HD-ZIP
Protein Properties Length: 833aa    MW: 89865.2 Da    PI: 6.3836
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_18.215genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.14.7e-21120175156
                                   TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                      Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                   +++ +++t++q++eLe+lF+++++p++++r eL+k+l L++rqVk+WFqNrR+++k
  evm.model.supercontig_18.215 120 KKRYHRHTPQQIQELEALFKECPHPDEKQRLELSKRLCLETRQVKFWFQNRRTQMK 175
                                   688999***********************************************999 PP

2START2114.4e-663345572206
                                   HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT- CS
                         START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWd 73 
                                   la++ ++elvk+a+ +ep+W +s     e++n +e++++f++  +     + +ea+r++g+v+ ++  lve+l++++ +W 
  evm.model.supercontig_18.215 334 LALAGMDELVKMAQTDEPLWIRSLeggrEILNHEEYMRTFTPCIGlkpngFVTEASRETGMVIINSLALVETLMNSN-RWA 413
                                   788899***********************************99999*9*9***************************.*** PP

                                   TT-S....EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSE CS
                         START  74 etla....kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvv 143
                                   e+++    + +t++vis g      galqlm aelq+lsplvp R++ f+R+++q+ +g+w++vdvS+ds ++ p  +s+v
  evm.model.supercontig_18.215 414 EMFPcmiaRTSTTDVISGGmggtrnGALQLMHAELQVLSPLVPvREVNFLRFCKQHAEGVWAVVDVSIDSIRETPGAPSFV 494
                                   ********************************************************************************* PP

                                   E-EESSEEEEEEEECTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                         START 144 RaellpSgiliepksnghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                                    +++lpSg+++++++ng+skvtwveh++++++++h+l+r+l++sg+ +ga++wvatlqrqce+
  evm.model.supercontig_18.215 495 SCRKLPSGCVVQDMPNGYSKVTWVEHAEYDESQVHQLYRPLLGSGMGFGAQRWVATLQRQCEC 557
                                   *************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.2E-20103177IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-21107177IPR009057Homeodomain-like
PROSITE profilePS5007117.216117177IPR001356Homeobox domain
SMARTSM003899.9E-18118181IPR001356Homeobox domain
CDDcd000861.36E-18119177No hitNo description
PfamPF000461.4E-18120175IPR001356Homeobox domain
PROSITE patternPS000270152175IPR017970Homeobox, conserved site
PROSITE profilePS5084843.765324560IPR002913START domain
SuperFamilySSF559611.26E-34326557No hitNo description
CDDcd088752.33E-129328556No hitNo description
SMARTSM002341.7E-50333557IPR002913START domain
PfamPF018521.0E-57334557IPR002913START domain
SuperFamilySSF559615.1E-24585755No hitNo description
SuperFamilySSF559615.1E-24785825No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009827Biological Processplant-type cell wall modification
GO:0042335Biological Processcuticle development
GO:0043481Biological Processanthocyanin accumulation in tissues in response to UV light
GO:0048765Biological Processroot hair cell differentiation
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 833 aa     Download sequence    Send to blast
MSFGGFLDSS TGGGGARIVA DISYGNHNHH NAGANMPSGA IAQPRLLSPS LTKSMFHSPG  60
LSLALQQPNI DNQGDVTGMG ENFEGSVNRR SREEESRSGS DNMDGASGDD QDVADKPPRK  120
KRYHRHTPQQ IQELEALFKE CPHPDEKQRL ELSKRLCLET RQVKFWFQNR RTQMKTQLER  180
HENTLLRQEN DKLRAENMSI RDAMRNPICS NCGGPAILGE VSLEEQHLRI ENARLKDELD  240
RVCALAGKFL GRPISSLGAS IAGPMPNSAL ELGVGTTNGF GGLTTVSSAT LPLVPADFGG  300
GISGPLQIVT SNRPVTTGLT GLDRSIERSM FLELALAGMD ELVKMAQTDE PLWIRSLEGG  360
REILNHEEYM RTFTPCIGLK PNGFVTEASR ETGMVIINSL ALVETLMNSN RWAEMFPCMI  420
ARTSTTDVIS GGMGGTRNGA LQLMHAELQV LSPLVPVREV NFLRFCKQHA EGVWAVVDVS  480
IDSIRETPGA PSFVSCRKLP SGCVVQDMPN GYSKVTWVEH AEYDESQVHQ LYRPLLGSGM  540
GFGAQRWVAT LQRQCECLAI LMSSAVPSRD HTAITASGRR SMLKLAQRMT DNFCAGVCAS  600
TVHKWNKLSV GNVDEDVRVM TRKSVDDPGE PPGIVLSAAT SVWLPVSPQR LFDFLRDERL  660
RSEWDILSNG GPMQEMAHIA KGQDHGNCVS LLRASAMNAN QSSMLILQET CIDAAGSLVV  720
YAPVDIPAMH VVMNGGDSAY VALLPSGFAI VPDGPGSRGP TVPNGPTSCN GAGSDGGVGG  780
PQRVGGSLLT VAFQILVNSL PTAKLTVESV ETVNNLISCT VQKIKAALQC ES*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00421DAPTransfer from AT4G00730Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002320755.10.0homeodomain family protein
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLB9IC550.0B9IC55_POPTR; Homeodomain family protein
STRINGPOPTR_0014s07130.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM112827105
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein